PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J01116.1.p
Common NameEUGRSUZ_J01116
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 473aa    MW: 55334.2 Da    PI: 7.9566
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J01116.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR157.15.8e-18785991
              FAR1  9 evGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91
                      e GF vrk ++ k+ r+geit+rtf C+++g++ +++++  +++ +rae r+gC a++k k + +g++ev++ ++eHnH+++p
  Eucgr.J01116.1.p  7 EKGFGVRKGHTVKN-RKGEITRRTFLCNCKGYSVTSSDQ--EKKFERAEVRCGCPAHIKFKVD-NGVYEVIEYVSEHNHTFVP 85
                      67********9999.7788**************999877..9999*****************9.***************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.6E-16785IPR004330FAR1 DNA binding domain
PfamPF105511.2E-31181275IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MWLMQLEKGF GVRKGHTVKN RKGEITRRTF LCNCKGYSVT SSDQEKKFER AEVRCGCPAH  60
IKFKVDNGVY EVIEYVSEHN HTFVPEDQNH LIRCGNTCKG VLSGMMKAGI CGTMAYKFLA  120
NEAGGSKNLD FILRDCQKNL QTESNKIMEG GDCQQLLNHF HRMQMQNLMF FYVVQDCFGD  180
VLVFDSTYRT NRYSLICAPF VGVNHHWKNT VFGCAFLLDE TAESFIWLFN VFLESMRDKA  240
LKTIFTDQDQ VMAKAIRVVF PNTQHRLCTW HIIQNAIKNI PQFYHKPDFR NKYFFRLMNR  300
CKSEDEFEST WMEMEEEWDT QNNNWLQRLY GLRHKWSSAF GRDIFSCGIR SSQRNESTNN  360
VFRHISKKTS SLIKFVYYYE EQLKHIREIE IQDDYRCRGK LRLQVSSNEL LEHAAAIYTH  420
TIFQKFSEEL MECLSVDVSG TTFDGSVYSY TIRFNPVELS ISCECKLFES KG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J01116.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010027018.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A059ADA90.0A0A059ADA9_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.16e-76FAR1-related sequence 5